Free Game UI Assets
Home / Assets / Panels / panel_rect_parchment_chamfer_03

panel_rect_parchment_chamfer_03

Free panel game UI asset · tint · SVG · CC0 1.0

panel_rect_parchment_chamfer_03 — game UI panel
parchmentbrownpanelfantasyrpgchamferscifirich

This asset is released under CC0 1.0 Universal (public domain). You can use, modify and redistribute it for free, including in commercial games, with no attribution required. See the license page for details.

Related panels