Free Game UI Assets
Home / Assets / Panels / panel_rect_black-silver_chamfer_01

panel_rect_black-silver_chamfer_01

Free panel game UI asset · metallic · SVG · CC0 1.0

panel_rect_black-silver_chamfer_01 — game UI panel
blacksilverpanelnightstealthchamferscifibasic

This asset is released under CC0 1.0 Universal (public domain). You can use, modify and redistribute it for free, including in commercial games, with no attribution required. See the license page for details.

Related panels