Free Game UI Assets
Home / Assets / Decorations / deco_grid_brick_01

deco_grid_brick_01

Free decoration game UI asset · grid · SVG · CC0 1.0

deco_grid_brick_01 — game UI decoration
brickmasonrywallpatterncastlemedievaldecoration

This asset is released under CC0 1.0 Universal (public domain). You can use, modify and redistribute it for free, including in commercial games, with no attribution required. See the license page for details.

Related decorations